Protein Info for MPMX19_04361 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 64 to 86 (23 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 237 to 253 (17 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 278 to 311 (34 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 301 (287 residues), 117.2 bits, see alignment E=3.9e-38

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 97% identity to azl:AZL_a04180)

Predicted SEED Role

"Predicted nucleoside ABC transporter, permease 2 component" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>MPMX19_04361 hypothetical protein (Azospirillum sp. SherDot2)
MEDALLLALQLLGATIRVATPLVLAAFAGMYCERAGVVDIGLEGKMLAGAFFSAAVASAT
LNPWLGLLAGIAAGVALAIVHGFACITHNGNQVVSGMAINILVAGLAPTLAYAWFQQGGQ
TPLLPNQARIPAVELPGVEALSGVPVLGPVYRELLNGNNVLIWVTLVLVIATHWVLYRSR
FGLRLRAVGENPAAVDTAGLSVAKLRYQALLVTGVLTGMAGSYLSTGHGAGFVRDMTAGK
GYLALAALIFGKWRPGPTLFACLLFAFTDAVQVRLQGVVLPGIGVIPVQFIQMLPYVLTV
LLLAGFVGKAIAPKASGIPYVKER