Protein Info for MPMX19_04358 in Azospirillum sp. SherDot2

Annotation: Pseudopaline exporter CntI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details PF00892: EamA" amino acids 23 to 151 (129 residues), 47.6 bits, see alignment E=1e-16 amino acids 163 to 286 (124 residues), 31 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_a04210)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MPMX19_04358 Pseudopaline exporter CntI (Azospirillum sp. SherDot2)
MTDAETADLLPAEADSVPYAVGCFLGAILLFAAMDTLIKFLTADYPVPQLMFVRSLVAFL
LVGGYTLTCGGGIAAMRTRRPLGHVWRAFAGLISMGCFFYAFRELPLADVYVLSFAGPLF
ITALSAPLLGEPVGWRRWAAVVVGFGGVVVMAQPSAGAPLVPVLVGLCAALFYALAALAV
RGLSRTETSASIVLYLLLTTTVVSGALAVPVWTAPTAFALGLMALVGAIGAGAQVLLTQA
FRRAPPAVVAPFEYTGMVWASLFGWLVFGDLPTEPVLAGAMVIIGSGLYILHRETMVARR
RLGS