Protein Info for MPMX19_04309 in Azospirillum sp. SherDot2

Annotation: Bifunctional transcriptional activator/DNA repair enzyme Ada

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF02805: Ada_Zn_binding" amino acids 23 to 87 (65 residues), 109.2 bits, see alignment E=2e-35 PF00165: HTH_AraC" amino acids 115 to 146 (32 residues), 38.4 bits, see alignment (E = 2.6e-13) PF12833: HTH_18" amino acids 118 to 195 (78 residues), 73.5 bits, see alignment E=3.6e-24 PF02870: Methyltransf_1N" amino acids 209 to 279 (71 residues), 22.9 bits, see alignment E=3.3e-08 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 282 to 361 (80 residues), 112.8 bits, see alignment E=2.9e-37 PF01035: DNA_binding_1" amino acids 283 to 362 (80 residues), 119.4 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 52% identical to ADA_ECOLI: Bifunctional transcriptional activator/DNA repair enzyme Ada (ada) from Escherichia coli (strain K12)

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 89% identity to azl:AZL_a05180)

MetaCyc: 52% identical to DNA-binding transcriptional dual regulator / DNA repair protein Ada (Escherichia coli K-12 substr. MG1655)
2.1.1.M37 [EC: 2.1.1.M37]; Methylated-DNA--[protein]-cysteine S-methyltransferase. [EC: 2.1.1.M37, 2.1.1.63]; 2.1.1.63 [EC: 2.1.1.M37, 2.1.1.63]

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63 or 2.1.1.M37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>MPMX19_04309 Bifunctional transcriptional activator/DNA repair enzyme Ada (Azospirillum sp. SherDot2)
MTVALDAAAPAIADPAITDVEAERWEALRRRDPAADGRFVYAVRSTGVYCRPSCAARPAR
PENVAFYATNAEAEQAGFRPCKRCRPDGPSQGDRRAEAVAVACRLIEEAEEAPQLDELAA
AAGMSPHHFHRIFKQVTGVTPRAYVQAQRAARVADALQQAGSVTEAIYEAGYGSSGRFYE
TAGARLGMTPTSYRRGGAGETIRFAVGISSLGSILVAATERGVCAILLGDDPDLLLRDLQ
DRFPRAELIGGDPAFEATVAQVVGFIEVPGTGLALPLDIGGTAFQQRVWQALRAIPAGRT
ASYAEIATAIGEPAAVRAVARACGVNPLAVAIPCHRVVRSDGGLSGYRWGVERKRDLLDR
ERKEATR