Protein Info for MPMX19_04305 in Azospirillum sp. SherDot2

Annotation: Hydrazine synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF10282: Lactonase" amino acids 16 to 89 (74 residues), 22.6 bits, see alignment E=1.4e-08 amino acids 183 to 313 (131 residues), 26.5 bits, see alignment E=9.3e-10 TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 18 to 324 (307 residues), 513.7 bits, see alignment E=1.5e-158 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 27 to 64 (38 residues), 46.8 bits, see alignment 2.2e-16 amino acids 107 to 145 (39 residues), 35.4 bits, see alignment 7.9e-13 amino acids 283 to 323 (41 residues), 53.9 bits, see alignment 1.3e-18 PF21783: YNCE" amino acids 69 to 251 (183 residues), 44.2 bits, see alignment E=4.2e-15

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_a05210)

Predicted SEED Role

"FIG00443700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MPMX19_04305 Hydrazine synthase subunit beta (Azospirillum sp. SherDot2)
MTAARFTGISLAALIAATLASAASAQTIYVSNEKDNTLSVIDGKTMAVTDTIKVGKRPRG
ITLSKDGTQLFICASDDHTVQVFDLASKTVVHNLPSGEDPEQFALSPDGKSLIIANEDSN
IVTVVDVPTRKVAFQVDVGVEPEGMDVSPDGRWGVNTSETTSMVHWIDMEKRTVVDNTLV
GPRPRYAQFTKDGSQLWVSSEIGGTVSVIDTATRQVKKVVDFHIKGVAKDRIQPVGVKLT
DDGRYAFVALGPANHVAVVDARTFEVKDYLLVGRRVWHLALTPDQKMLYTTNGVSGDVSV
IDVDSLKVTKTVKVGRYPWGVAVKG