Protein Info for MPMX19_04274 in Azospirillum sp. SherDot2

Annotation: RNA polymerase sigma-H factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 11 to 165 (155 residues), 80.6 bits, E=5e-27
• PF04542: Sigma70_r2
  • amino acids 16 to 82 (67 residues), 68.5 bits, E=5.4e-23
• PF08281: Sigma70_r4_2
  • amino acids 111 to 160 (50 residues), 49.5 bits, E=4e-17
• PF04545: Sigma70_r4
  • amino acids 115 to 163 (49 residues), 37.3 bits, E=2.4e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 43% identity to atu:Atu3084)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Protein Sequence (178 amino acids)

>MPMX19_04274 RNA polymerase sigma-H factor (Azospirillum sp. SherDot2)
MADAAAGDRKAFGTLTRRHLRRSIALAQRVVGNAADAEEVAQDAFLQIWANADRWRGDGT
RFTTWLYRIVVNRAIDYKRRRSFAPLDAADEIADPAWSAETVIDGIRIGAAVDAAIAALP
ERQRAALSLCYHEEMTCAEASEILQVSVSAMESLLVRARRVVRARLQPLIRQKDGARS