Protein Info for MPMX19_04261 in Azospirillum sp. SherDot2

Annotation: putative membrane transporter protein YfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details PF01925: TauE" amino acids 6 to 240 (235 residues), 123.1 bits, see alignment E=7.6e-40

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 92% identity to azl:AZL_a05730)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>MPMX19_04261 putative membrane transporter protein YfcA (Azospirillum sp. SherDot2)
MIELILLAAAFFAGAMNAVAGGGSFLTLPALIYAGVPPVAANATGTVALLPGYASGVYGY
RQDLTPVGTLSLPLLSAVSLVGGLAGAGLLLVTPDSVFRGIVPWLLLLATGLFAFGTMLA
QRLRSLGLHGNGAMLGTLFVVSVYGGYFNGGLGILLLAQLSLFGMTDLNAMNGLKNLFSA
VLTAIAVVAYAAGGAVEWPKALLMTVAAVAGGYVGARLGRRIPKPVLRAGIIAIGLVMSA
VFFLK