Protein Info for MPMX19_04251 in Azospirillum sp. SherDot2

Annotation: C4-dicarboxylate transport transcriptional regulatory protein DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00072: Response_reg" amino acids 17 to 125 (109 residues), 101.2 bits, see alignment E=9.9e-33 PF00158: Sigma54_activat" amino acids 156 to 322 (167 residues), 231.6 bits, see alignment E=1.1e-72 PF14532: Sigma54_activ_2" amino acids 157 to 327 (171 residues), 87.6 bits, see alignment E=2.3e-28 PF07728: AAA_5" amino acids 179 to 297 (119 residues), 34.2 bits, see alignment E=6.1e-12 PF02954: HTH_8" amino acids 411 to 447 (37 residues), 29.2 bits, see alignment 1.6e-10

Best Hits

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 94% identity to azl:AZL_a05630)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein dctD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>MPMX19_04251 C4-dicarboxylate transport transcriptional regulatory protein DctD (Azospirillum sp. SherDot2)
MSRSIPEVAGPEAAGSVIFVDDERAVRLAGQQALELAGFEVTACDGAERALRHIGRNWPG
CLVTDVRMPQMDGLALLARVQEIDPDLPVILITGHGDVPMAVEAMRNGAYDFLEKPFPSD
RLTEVARRAVEKRRLVMENRRLRAQIAGGVDPAESIVGRTPGIERLRTTIAAVADTDADV
LVFGETGTGKEMVARALHAASGRRKNPFVALNCGAMPESIFESELFGHEAGAFTGAAKRR
VGRIEHAGGGTLFLDEIESMPLALQVKLLRVIQERVVEPLGSNEQVPVDLRVVAATKSDL
RQAADAGKFRADLYYRLNVVVLTIPPLRERRDDIPLLFQHFVAQAAARYNREPRVPSRDQ
MQRLMGQDWPGNVRELRNAADRFVLGLEDVVPAPVTAPSALSLAEQVDLYEKGLIQAELA
RHRGSVKAAIEALNIPRKTFYDKLKRYGLSRDDFLD