Protein Info for MPMX19_04234 in Azospirillum sp. SherDot2

Annotation: Disulfide-bond oxidoreductase YfcG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 4 to 81 (78 residues), 47.5 bits, E=5.5e-16
• PF13417: GST_N_3
  • amino acids 4 to 83 (80 residues), 31.2 bits, E=6.9e-11
• PF13409: GST_N_2
  • amino acids 10 to 81 (72 residues), 42.5 bits, E=2.4e-14
• PF13410: GST_C_2
  • amino acids 128 to 191 (64 residues), 27.9 bits, E=6.2e-10
• PF00043: GST_C
  • amino acids 134 to 197 (64 residues), 38.2 bits, E=4.3e-13
• PF14497: GST_C_3
  • amino acids 135 to 200 (66 residues), 27.9 bits, E=6.7e-10

Best Hits

Swiss-Prot: 60% identical to YFCG_ECOLI: Disulfide-bond oxidoreductase YfcG (yfcG) from Escherichia coli (strain K12)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 95% identity to azl:AZL_a05560)

MetaCyc: 60% identical to disulfide bond oxidoreductase YfcG (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (4/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (235 amino acids)

>MPMX19_04234 Disulfide-bond oxidoreductase YfcG (Azospirillum sp. SherDot2)
MIDLYFWPTPNGHKITIFLEEAGLDYSFKPVNISTGDQFKPDFLAFSPNNRMPAIIDTAP
ADGGEPISVFESGAILVYLAEKTGKFLPGDVRGRKTVLEWLFWQVGGLGPMAGQNHHFVQ
YAPERIPYAMERYVKETSRLYGVMDKRLADNEFLGGAELSIADMASYPWIVPYERQQQDL
DNFPNLKRWFTAIKERPAVVRAYEKGQEINPNRTPTVNEDSKKILFGQSADTVKR