Protein Info for MPMX19_04192 in Azospirillum sp. SherDot2

Annotation: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01258: phosphoglycerate mutase 1 family
  • amino acids 3 to 235 (233 residues), 342.3 bits, E=7.2e-107
• PF00300: His_Phos_1
  • amino acids 4 to 125 (122 residues), 100.8 bits, E=4.2e-33
  • amino acids 137 to 208 (72 residues), 24.3 bits, E=1.1e-09

Best Hits

Swiss-Prot: 62% identical to GPMA_GEOMG: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 89% identity to azl:AZL_a06650)

MetaCyc: 55% identical to 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Escherichia coli K-12 substr. MG1655)
RXN-15513 [EC: 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• homolactic fermentation (12/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• Rubisco shunt (10/10 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• heterolactic fermentation (15/18 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• gluconeogenesis III (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• glycolysis IV (8/10 steps found)
• gluconeogenesis I (10/13 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• photorespiration II (6/10 steps found)
• glycerol degradation to butanol (10/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11

Protein Sequence (253 amino acids)

>MPMX19_04192 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Azospirillum sp. SherDot2)
MHRLILLRHGQSVWNAEDRFTGWTDVGLTDRGIAETRKAAELLKAAGIDVDIAFTSVLSR
AIETLHLVLRDMDRLWLPVHKHWRLNERHYGALQGLNKAETAERHGAEQVFQWRRSWDVP
PPAIEPDDPRSAVTDRRYAGLAKANLPRGESLKDTTERVIPFWRDEIAPALRLGARVLVS
AHGNSLRGLVKHLDNVDDQDIPLFEIPTSRPLVYELGADLTPLRRYFLGENGAVEEIGWP
KREGTDKDSIAAT