Protein Info for MPMX19_04179 in Azospirillum sp. SherDot2

Annotation: D-inositol-3-phosphate glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF13439: Glyco_transf_4" amino acids 44 to 164 (121 residues), 35.7 bits, see alignment E=2.7e-12 PF13579: Glyco_trans_4_4" amino acids 50 to 156 (107 residues), 51.3 bits, see alignment E=5.3e-17 PF20706: GT4-conflict" amino acids 124 to 286 (163 residues), 35.1 bits, see alignment E=2.4e-12 PF00534: Glycos_transf_1" amino acids 182 to 337 (156 residues), 123.9 bits, see alignment E=1.6e-39 PF13692: Glyco_trans_1_4" amino acids 185 to 324 (140 residues), 122.5 bits, see alignment E=5e-39 PF13524: Glyco_trans_1_2" amino acids 214 to 346 (133 residues), 25 bits, see alignment E=4.8e-09

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_a06960)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>MPMX19_04179 D-inositol-3-phosphate glycosyltransferase (Azospirillum sp. SherDot2)
MIYIVSPGGTQEKGGMGRVVDNFTTDFRQNCPDVKFEVIDSYGPGKFHLMPLYFARATAR
LAGCFAAGKADLVHIHMAEYGSVLRKGILIAMARTFGVPVILHLHGGRFPKQFKDAGPVM
RWAIRRMMAMTSEIVVLGEFWRDWVAEAFGPEARQRTTLLHNAVPGPASPPVRDDAEEDF
AGPVRLLFLGRLIKLKGIDVLLNALASPTCRDRNWQVTIAGDGDLETYRSLATELGIADR
VRFTGWLDQAGCRRELAGAHVLVQPSMFEGLPMSVLEAMAEGLTIIATPVGSVPDAIADG
ETGLLVPPGDVAALADTLARVIDDRTLRRNLSAGARARWERQFDVAVFRERLLEIYRRNA
RGSLSTSPAVPAGPVPAAGPAGHSKSTTG