Protein Info for MPMX19_04174 in Azospirillum sp. SherDot2

Annotation: NH(3)-dependent NAD(+) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02540: NAD_synthase
  • amino acids 22 to 108 (87 residues), 60.9 bits, E=5.5e-21
  • amino acids 171 to 308 (138 residues), 98.8 bits, E=1.4e-32
• TIGR00552: NAD+ synthetase
  • amino acids 121 to 318 (198 residues), 109 bits, E=1.2e-35

Best Hits

Swiss-Prot: 54% identical to NADE_RHIME: NH(3)-dependent NAD(+) synthetase (nadE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 94% identity to azl:AZL_a07010)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.5

Use Curated BLAST to search for 6.3.1.5

Protein Sequence (334 amino acids)

>MPMX19_04174 NH(3)-dependent NAD(+) synthetase (Azospirillum sp. SherDot2)
MLNALTSFDSKALDLDCAAAAREIEDAIQRIVAHDLRRQGIVLGVSGGIDSSVCATLAVR
ALGPERVLCILMPEKENSPKSTRLGTLLCEHLGVTPVMENITGPLEALGCYERRDNAIRR
LFPEFGPGWKQKIGLAGNLLDADRVNYFTLTVESPDGERQTSRMPVDVYLDVVAATNLKQ
RMRKTVEYTHADRLNYAVLGTPNRLEYELGFFVRGGDGLADLKPIAHLYKSQVYQMAAYL
GLPAEIQAQSPSTDTYTLPQSQEEFYYALPYDKLDLALCAYGRGASEEEAAEALNLTVQQ
VHRVYKDITAKRRTSARILRDAHLVQPVSVGDEA