Protein Info for MPMX19_04132 in Azospirillum sp. SherDot2

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 219 to 245 (27 residues), see Phobius details PF08521: 2CSK_N" amino acids 34 to 171 (138 residues), 114.9 bits, see alignment E=6.1e-37 PF00512: HisKA" amino acids 255 to 319 (65 residues), 52.6 bits, see alignment E=7.9e-18 PF02518: HATPase_c" amino acids 372 to 481 (110 residues), 80.4 bits, see alignment E=2.7e-26

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 85% identity to azl:AZL_a03060)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>MPMX19_04132 Adaptive-response sensory-kinase SasA (Azospirillum sp. SherDot2)
MAAIRVGRPERVPPHVPSLRRRLLTRLLVPLGALAVGLGVGGSALIHGFVQSTHDRLLAG
STLAIAERLAVGDDDGEVTVDLPAVAFGMLESQARDNIYYNVAHEGGVITGYLDLPLPDI
QAMPANVTVFRDASYHGHPVRVAAQVRRLYGVPQPVLVQVAETTAGRRALEVDLLLWLTL
LEVALVGGSGMLVWGAVGRGLAPLKRLRRVIDDRSARGGMALVPLPLAVVPAEVLPLVVA
INGLLARLDQSIGTMRRFTADASHQLRTPLAVLRTHLALLRRYGTDSAEGRAALDDVEGA
VKRLERLLVQLLALARADEDSPVVPAAPEVTDLMQVAMEVAAEQVPAALAQDVEVRFEGP
EDGSALRVAGNAVLVGELLGNLLDNAIRYNRPGGTVTVRVAEEPATGPVMEVEDDGPGIP
EAERGRVFERFYRLDRPGEPPRTGSGLGLAIVRALADRLGASVRLDAGAEGKGLKVTVTL
RGASGEACGLPEISLSPPGRGD