Protein Info for MPMX19_04068 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 64 to 90 (27 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 262 (179 residues), 41.8 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 96% identity to azl:AZL_a07830)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>MPMX19_04068 hypothetical protein (Azospirillum sp. SherDot2)
MHSLSNRRGWGFWLQLGFTLLVCALLTVPMAMSMLAGLTANYFVGLKSGLTLRWVDEVLR
VYSGTILLSLQIAFACLACTLVLGVPAAYALARRPGRIARLVEEMLMMPVAIPGLATALA
LIVTYGGVGDLRSSWLFILIGHVLFTLPFMVRAVLAVMGSIDLTTLEEGAASLGAGFLRR
FATVVLPNCRSGILAGSLMVLTLSVGEFNLTWLLHTPLTKTLPVGLADSYASLRIEIGSA
YTLVFFLMIVPSLILMQGLSRRGRPSV