Protein Info for MPMX19_04063 in Azospirillum sp. SherDot2

Annotation: scyllo-inositol 2-dehydrogenase (NADP(+)) IolW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 5 to 120 (116 residues), 87.8 bits, see alignment E=1.4e-28 PF03447: NAD_binding_3" amino acids 12 to 114 (103 residues), 30 bits, see alignment E=1.1e-10 PF02894: GFO_IDH_MocA_C" amino acids 132 to 334 (203 residues), 110.5 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 44% identical to IOLW_BACSU: scyllo-inositol 2-dehydrogenase (NADP(+)) IolW (iolW) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 91% identity to azl:AZL_a07880)

MetaCyc: 44% identical to scyllo-inositol dehydrogenase (NADP+) (Bacillus subtilis subtilis 168)
RXN-14347 [EC: 1.1.1.371]

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18 or 1.1.1.371

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX19_04063 scyllo-inositol 2-dehydrogenase (NADP(+)) IolW (Azospirillum sp. SherDot2)
MKSLSVGLLGFGLAGSVFHAPLIQSEPRLRLTAVASSRTDDIRRSVPGAQVTTAEAVIAD
PAIDLVVIATPNTSHAPLAREALLAGKHVVIDKPMATTAAEAGELIDLARRQGRLLTVFH
NRRWDNDFLTLRACLEAGEVGRPYHYEAHYDRFRPQIKQGWRERMLPGSGVLFDLGAHLI
DQAVTLFGMPDRILADVGAQRPDAEVDDWFHIVLGYGPMRAILHCGTVVCRPGPRFQLHG
DGGSFLKHGIDGQEAALRAGRLPTEAGWGLDDPENHALLVRADGTERRVETLRGDYPAFY
RGVAAAILDGAPPPVAAEQARDVLSVLEAVRKAAGLPA