Protein Info for MPMX19_03994 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF00353: HemolysinCabind" amino acids 17 to 51 (35 residues), 33.7 bits, see alignment (E = 1.4e-12) TIGR04534: ELWxxDGT repeat" amino acids 137 to 177 (41 residues), 41.2 bits, see alignment 7e-15 amino acids 180 to 226 (47 residues), 79.5 bits, see alignment 7.2e-27 amino acids 228 to 274 (47 residues), 70.6 bits, see alignment 4.5e-24 amino acids 277 to 311 (35 residues), 60.8 bits, see alignment (E = 5.3e-21) amino acids 391 to 411 (21 residues), 33.7 bits, see alignment (E = 1.4e-12) amino acids 428 to 473 (46 residues), 58.4 bits, see alignment 2.9e-20 amino acids 475 to 518 (44 residues), 59.5 bits, see alignment 1.3e-20

Best Hits

Predicted SEED Role

"Flagellar hook-length control protein FliK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (569 amino acids)

>MPMX19_03994 hypothetical protein (Azospirillum sp. SherDot2)
MGWDQAQAHGASGRRITGSAHRDLLFGGNGNNTIAGHRGNDYMEGGAGSDRFVLDPGDGW
DCIGDFQGGAGGDLLDLRGWGGIGSLEDVLAHSHQDGDGLVLDFGPRDGVKLMGLSRDDL
TADNLRLKASRLKADAVFAASDSGHGGELWGTDGRRAFRLRDIAPGTASSDPQGLVEADG
HAYFSADDGVHGRELWMTDGTPGGTRMVADIHPGVAGSGPTALTVVDGKLYFQAHDGQHA
TELWVSDGTAAGTHMVKDIADKPAGSYPYDLTAVGDELFFSATDSEHGRALWRSDGTAAG
TVLVKDFFPGGFDPPVPLPIFPGHLTAGGEEGQRRRLFLTGWDGTGSYSQLWVTDGTLAG
TVKLLEGLGEDPKSGHTLSLAMAGDTLFFNRGDDLWKSDGTPAGTVLVKDFPSLGFSRSK
QFFAFDDQVAFVAGSEQNGYELWTSDGTELGTRMVKDIAPGRADANIANITVVDDTLFFT
ADDGVHGDSLWRSDGTAAGTRMVMDKAHHTGWTQPTSLDAAGGSLYFSATDSTQAAALFR
LDMDRGVVTELAGAQPFSLPNGGLQVVGV