Protein Info for MPMX19_03993 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 102 to 103 (2 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 33 to 188 (156 residues), 52.8 bits, see alignment E=3.7e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 203 to 364 (162 residues), 174.1 bits, see alignment E=9.8e-56 PF00990: GGDEF" amino acids 207 to 362 (156 residues), 161.4 bits, see alignment E=1.6e-51

Best Hits

KEGG orthology group: None (inferred from 76% identity to azl:AZL_a08350)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>MPMX19_03993 hypothetical protein (Azospirillum sp. SherDot2)
MEEPSATGTIVTALAGGIGLLALMTLIYGTVLYRLGDRPRLRQFCLGLMFGAGGVAAMLQ
SVPILPGIYLDVKTVPVALAAPFGGPLAAVLAVALVSAARLALGGAGMVSGVIGILAVGS
VGLLVRWLVPVTGWRTARPLFILAPVAALHPFCIFLLPWEVALPAFVNGALPIALFTAGG
ILMLGTMLGREHRRVDTEKMLRDASLSDPLTGLANRRAFFAAIDRTVAGALRHDTPVSLL
MLDIDHFKAVNDSRGHDAGDAVLVALSRLLQRSVRQSDLVARFGGEEFAILLPNAPIDGA
SLLAERLRCAVRDLAIAQDGAVLHVTASIGVSTLSAGTDRADAMIKAADMALYRAKQGGR
DRVCRQHEAIVKEPVPAAE