Protein Info for MPMX19_03925 in Azospirillum sp. SherDot2

Annotation: L-methionine sulfoximine/L-methionine sulfone acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF13420: Acetyltransf_4" amino acids 12 to 165 (154 residues), 53.4 bits, see alignment E=4.7e-18 PF00583: Acetyltransf_1" amino acids 42 to 145 (104 residues), 52.3 bits, see alignment E=9.8e-18 PF13508: Acetyltransf_7" amino acids 61 to 146 (86 residues), 29.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 57% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 87% identity to azl:AZL_a02140)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>MPMX19_03925 L-methionine sulfoximine/L-methionine sulfone acetyltransferase (Azospirillum sp. SherDot2)
MVSIAGPAITVRASADADIPAITALYARHVLHGTASFEEIPPDEAEIARRRADILGRGLP
YLAAECEGRLVGYAYAGLYRTRSAYRFTLENSVYVADGMGRRGIGRALMDPLIEMCEAAG
YRRMIAAIGDSANHGSIGLHSACGFRPVGILPAVGFKFGRWLDGVLMERPLGDGSDSPPA
G