Protein Info for MPMX19_03819 in Azospirillum sp. SherDot2

Annotation: NADP-reducing hydrogenase subunit HndA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01257: 2Fe-2S_thioredx
  • amino acids 3 to 142 (140 residues), 150.2 bits, E=1.8e-48

Best Hits

Swiss-Prot: 36% identical to HNDA_DESFR: NADP-reducing hydrogenase subunit HndA (hndA) from Desulfovibrio fructosivorans

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 94% identity to azl:AZL_a00150)

Predicted SEED Role

"NAD-dependent formate dehydrogenase gamma subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Protein Sequence (170 amino acids)

>MPMX19_03819 NADP-reducing hydrogenase subunit HndA (Azospirillum sp. SherDot2)
MTIVEDNRHLRGALLPILHALQEEFGYIDEEAIPLLATELNLSRADVHGVVSFYHEFRRE
KPGRHTIKVCRAEACQSMGANALVDHIKTRLQVDFHGTTADGAFTLEPVFCLGNCALSPA
VMIDENLHGRVSPDRFDELAAETRANPHAHQQIPRALSHSHKDSHKGHAQ