Protein Info for MPMX19_03751 in Azospirillum sp. SherDot2

Annotation: Vitamin B12 import ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF00005: ABC_tran" amino acids 30 to 169 (140 residues), 118.3 bits, see alignment E=4e-38 PF09821: AAA_assoc_C" amino acids 305 to 423 (119 residues), 135 bits, see alignment E=1.9e-43

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 92% identity to azl:AZL_c01400)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>MPMX19_03751 Vitamin B12 import ATP-binding protein BtuD (Azospirillum sp. SherDot2)
MLNTRNTTIFELSGVRQAYAKPSGQDYVVLDNVDLTLRDGEIVGLLGRSGSGKSTLLRIV
AGLVKPTGGSVRHHGEPVAGPTDGVAMVFQTFALFPWLTVWENVMAGLKAKGVPAREAEA
RTEEAIDLIGLSGFESAYPKELSGGMRQRVGFARALVVHPEILLMDEPFSALDVLTAETL
RTDLLDLWMERRLPIKSILMVTHNIEEAVLMCDRILVFSSNPGRVAAEIRVNIAHPRNRL
DPQFRAMVDDIYGRMTARKPLVASSPAAKQPPAHAVPLEHVSTNLLAGLLETLASPAYHG
KADLPHLAAALQHEIDDLFPIAETLQMLGLAEVAEGDIHLTEPGRLFAESGLDDRKRLFA
EHLIRYVPLAAHIHGLLKEPATQRVPSSRIRAELTPFMSEGYAEETLKAVTSWARYAELF
TYDDETETFAFEDAD