Protein Info for MPMX19_03718 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 28 to 45 (18 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 394 to 411 (18 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details amino acids 503 to 519 (17 residues), see Phobius details amino acids 527 to 542 (16 residues), see Phobius details amino acids 564 to 586 (23 residues), see Phobius details PF03600: CitMHS" amino acids 17 to 533 (517 residues), 248.6 bits, see alignment E=1.4e-77 amino acids 485 to 580 (96 residues), 39.6 bits, see alignment E=5.3e-14 PF02080: TrkA_C" amino acids 221 to 285 (65 residues), 35.5 bits, see alignment E=1.1e-12 amino acids 307 to 369 (63 residues), 34.3 bits, see alignment E=2.7e-12 PF00939: Na_sulph_symp" amino acids 415 to 585 (171 residues), 50.4 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: None (inferred from 50% identity to mci:Mesci_6157)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>MPMX19_03718 hypothetical protein (Azospirillum sp. SherDot2)
MTLQQFMSFALVGIVVAMLIWNRWRFDVVAVLALLAGVFLGLIPAKDAFSGFADDIVIII
ASALIVSAGIARSGVIDALVRPVAAKLSTPTRQIAFLCGSVAFMSALMKNIGALAIFLPI
TMQLARRHRTGAHRVLMPMAFASLMGGLMTLVGTSPNIIVSRVRTEIVGQPFSMFDYLPV
GLGITVVGLLFLMVGWRLLPQDRSGARSAEETFAVENYASEMRLPAGSSFVGRTVRDVEA
LAEGEAQVIGLIRERFRRYVPDKHWTLMADDVLVLEGDAPALQRLVQGASLEPLGILEGA
EGELLAVEAVVTPDSPLAGKSDRSLDLRRRFGVSLLAVSRTGERLARRLHHVMFKEGDLL
LLQVPAERYPDALADASLIPLAERRLQLGRRRPVWVPVGILVVTMLVLGFHLAPLAVTFL
AAAAAMIVTGVLSVEDAYHAVEWPIIVLLAALIPVSGTLESTGATQVISTLLADAARGLP
AVACVALIMAAAMAVTPFLNNAATVLVMAPIGAGVAQQLGLSPDPFLMAVAVGAGSDFLT
PIGHQCNTLVMGPGGYRFGDYPRLGVPLSLIILALGTWLIVTFWPLGG