Protein Info for MPMX19_03689 in Azospirillum sp. SherDot2

Annotation: Transcriptional regulator MntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF01325: Fe_dep_repress" amino acids 44 to 99 (56 residues), 48.3 bits, see alignment E=2.8e-16 PF09339: HTH_IclR" amino acids 56 to 94 (39 residues), 26.7 bits, see alignment E=1.2e-09 PF12802: MarR_2" amino acids 59 to 95 (37 residues), 29.6 bits, see alignment 1.8e-10 PF01047: MarR" amino acids 60 to 95 (36 residues), 31.8 bits, see alignment 3.1e-11 PF02742: Fe_dep_repr_C" amino acids 102 to 156 (55 residues), 47 bits, see alignment E=6.8e-16

Best Hits

Swiss-Prot: 64% identical to MNTR_ECOL6: Transcriptional regulator MntR (mntR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11924, DtxR family transcriptional regulator, manganese transport regulator (inferred from 81% identity to mlo:mll2499)

Predicted SEED Role

"Mn-dependent transcriptional regulator MntR" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>MPMX19_03689 Transcriptional regulator MntR (Azospirillum sp. SherDot2)
MLYFQHPNIFPGGWGVTDSDADLPDAELHAEGFRKTREAQRTALAEDYVELIADLIESGQ
EARQVDIAARLGVAQPTVARMLDRLAADGLVYRKPYRAVFLTDAGRRIAEESRERHRTVV
AFLRSLGVSADTARIDAEGIEHHVSAETLDAFRRALAQGS