Protein Info for MPMX19_03685 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00805: Pentapeptide
  • amino acids 85 to 118 (34 residues), 40.1 bits, 3.1e-14
  • amino acids 119 to 158 (40 residues), 41.6 bits, 1.1e-14
  • amino acids 139 to 175 (37 residues), 30.9 bits, 2.3e-11
  • amino acids 159 to 198 (40 residues), 27.7 bits, 2.3e-10
  • amino acids 194 to 219 (26 residues), 20.4 bits, see alignment (E = 4.5e-08)

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_b04570)

Predicted SEED Role

"pentapeptide repeat family protein"

Protein Sequence (226 amino acids)

>MPMX19_03685 hypothetical protein (Azospirillum sp. SherDot2)
MTSHSKAALPRKLCRILALNALAVCLAAPVPAVLAAEMETAAIPAAVEEAALPVGGGEEE
RASVVNGCTLGPRIVCPNLDLRHRNLRGLSLAGADLHGANLMRADLRKADLRGADLTGAI
LDGADLRTAFLQGARLSGARLRGANLEFARATGADFTGSDLTAANLEAIRADKINLAGAS
LEGANLQEAKMALSNLSGANMDGAKLRFAIFQDALMTGCRSCPTGW