Protein Info for MPMX19_03673 in Azospirillum sp. SherDot2

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00140: Sigma70_r1_2" amino acids 30 to 58 (29 residues), 26.3 bits, see alignment (E = 8.9e-10) TIGR02392: alternative sigma factor RpoH" amino acids 31 to 298 (268 residues), 324.8 bits, see alignment E=4.9e-101 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 64 to 296 (233 residues), 98.6 bits, see alignment E=3.1e-32 PF04542: Sigma70_r2" amino acids 68 to 135 (68 residues), 67.3 bits, see alignment E=1.2e-22 PF04545: Sigma70_r4" amino acids 245 to 295 (51 residues), 57.6 bits, see alignment 1.1e-19

Best Hits

Swiss-Prot: 57% identical to RPOH_ZYMMO: RNA polymerase sigma factor RpoH (rpoH) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: None (inferred from 92% identity to azl:AZL_b04660)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MPMX19_03673 RNA polymerase sigma factor RpoH (Azospirillum sp. SherDot2)
MQRNAETRTTQTTVQAIAQTRPAEPRSAEPMQLYLQDARKYQYLTPEQEHDLAVRWHDNQ
EPAALDKLVGSHLRLVVKMARGYLGYGLPLSDLVAEGNVGVMQAAQKFDPGKGFRFATYA
SWWVRAAIQEYVLHNWSLVKIGTTAGQKKLFFSLRRLKARMQELESGDLSPEAVESIATE
LNVSKAEVVEMNRRLGNDRSLNVGLSEDGDAEWQDLLADDRPDQETTLADSEERRRRQQF
LKLGLGVLDDRERKILIARRLRDEPLTLEELSQTFHVSRERVRQLEVRAFEKLQKAVIAT
AKTEKVTMEKNRLLIDA