Protein Info for MPMX19_03671 in Azospirillum sp. SherDot2

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01135: PCMT
  • amino acids 28 to 116 (89 residues), 21.4 bits, E=6.9e-08
• PF01209: Ubie_methyltran
  • amino acids 30 to 238 (209 residues), 114 bits, E=2.6e-36
• PF13489: Methyltransf_23
  • amino acids 66 to 184 (119 residues), 39.9 bits, E=1.3e-13
• PF13847: Methyltransf_31
  • amino acids 70 to 173 (104 residues), 52.4 bits, E=1.8e-17
• PF13649: Methyltransf_25
  • amino acids 75 to 165 (91 residues), 72 bits, E=1.9e-23
• PF08242: Methyltransf_12
  • amino acids 76 to 166 (91 residues), 40.4 bits, E=1.4e-13
• PF08241: Methyltransf_11
  • amino acids 76 to 168 (93 residues), 73.6 bits, E=6.1e-24

Best Hits

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 52% identity to gox:GOX1390)

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• superpathway of menaquinol-8 biosynthesis I (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of menaquinol-10 biosynthesis (1/10 steps found)
• superpathway of menaquinol-11 biosynthesis (1/10 steps found)
• superpathway of menaquinol-12 biosynthesis (1/10 steps found)
• superpathway of menaquinol-13 biosynthesis (1/10 steps found)
• superpathway of menaquinol-6 biosynthesis (1/10 steps found)
• superpathway of menaquinol-7 biosynthesis (1/10 steps found)
• superpathway of menaquinol-9 biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Protein Sequence (259 amino acids)

>MPMX19_03671 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Azospirillum sp. SherDot2)
MPTESTPRVGTAVEPHPVLDAYYGDRTQRQRFVRGLFNRTAHHYDRINAIFALGSGSWYR
SQCLRRAGLQPGMRVLDVAIGTGLVAREAVSLCGNPGDVIGLDLSEAMLAEARRSLPIPL
IQGVADALPLADGSVDLVTIGYALRHVGDLTATFREFRRVLRPGGTVLVMEIGRPRRPVT
RHLMNAYLGMVVPAVSRLSGGGESGRTLMRYYWETIDRCVEPEVITAAMAAAGLAQVRCD
TDYDLFKNYTGKRQAEATA