Protein Info for MPMX19_03671 in Azospirillum sp. SherDot2

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF01135: PCMT" amino acids 28 to 116 (89 residues), 21.4 bits, see alignment E=6.9e-08 PF01209: Ubie_methyltran" amino acids 30 to 238 (209 residues), 114 bits, see alignment E=2.6e-36 PF13489: Methyltransf_23" amino acids 66 to 184 (119 residues), 39.9 bits, see alignment E=1.3e-13 PF13847: Methyltransf_31" amino acids 70 to 173 (104 residues), 52.4 bits, see alignment E=1.8e-17 PF13649: Methyltransf_25" amino acids 75 to 165 (91 residues), 72 bits, see alignment E=1.9e-23 PF08242: Methyltransf_12" amino acids 76 to 166 (91 residues), 40.4 bits, see alignment E=1.4e-13 PF08241: Methyltransf_11" amino acids 76 to 168 (93 residues), 73.6 bits, see alignment E=6.1e-24

Best Hits

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 52% identity to gox:GOX1390)

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>MPMX19_03671 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Azospirillum sp. SherDot2)
MPTESTPRVGTAVEPHPVLDAYYGDRTQRQRFVRGLFNRTAHHYDRINAIFALGSGSWYR
SQCLRRAGLQPGMRVLDVAIGTGLVAREAVSLCGNPGDVIGLDLSEAMLAEARRSLPIPL
IQGVADALPLADGSVDLVTIGYALRHVGDLTATFREFRRVLRPGGTVLVMEIGRPRRPVT
RHLMNAYLGMVVPAVSRLSGGGESGRTLMRYYWETIDRCVEPEVITAAMAAAGLAQVRCD
TDYDLFKNYTGKRQAEATA