Protein Info for MPMX19_03638 in Azospirillum sp. SherDot2

Annotation: Octopine transport system permease protein OccQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 126 (109 residues), 56.1 bits, see alignment E=2.2e-19 PF00528: BPD_transp_1" amino acids 46 to 224 (179 residues), 70.3 bits, see alignment E=8.9e-24

Best Hits

Swiss-Prot: 58% identical to NOCQ_AGRFC: Nopaline transport system permease protein NocQ (nocQ) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 71% identity to azl:AZL_028030)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MPMX19_03638 Octopine transport system permease protein OccQ (Azospirillum sp. SherDot2)
MLDLLDSGLTSGLHGWGPQLLSGTAMTVAVALSAFLLGLAFGAAGAAAKLSDSLVLRGLA
ELYTTAVRGVPELLVIYLLFFGGSGMVMAVAGLFGYGGLIELNAFSIGVAAVGLISGAYS
TEVIRGAVKSVPYGQIEAARACGMGRWRILRRVLVPQTLRFALPGLGNVWQLTLKDTALI
SVTALAEIMRVAHTAAGSTRQSFLFYSVAALLYLALTTVSTTAFRQAERYASRGVRRA