Protein Info for MPMX19_03636 in Azospirillum sp. SherDot2

Annotation: Octopine permease ATP-binding protein P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00005: ABC_tran" amino acids 49 to 207 (159 residues), 117.8 bits, see alignment E=5.7e-38 PF13304: AAA_21" amino acids 178 to 236 (59 residues), 29.2 bits, see alignment E=9e-11

Best Hits

Swiss-Prot: 64% identical to NOCP_AGRFC: Nopaline permease ATP-binding protein P (nocP) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 84% identity to azl:AZL_028010)

MetaCyc: 54% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Arginine/ornithine ABC transporter, ATP-binding protein AotP" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>MPMX19_03636 Octopine permease ATP-binding protein P (Azospirillum sp. SherDot2)
MDQHRIATDPIASVGRNGPAHRHPPSNPTATVAVQADGLHKRFGSLEVLKGVSLTAREGD
VITLIGSSGSGKSTLLRCINMLEVPDEGRVTICGETIAMKTARGRTLPANTRQVDRIRTS
LGMVFQNFNLWSHMTILQNVIEAPVHVLGVPKGEAIDLARSLLDKVGILGKADCYPIQLS
GGQQQRAAIARALAMQPKVMLFDEPTSALDPELVGEVLRVIRQLADEGRTMILVTHEMDF
AREVSSKVVFLHQGRIEEEGAPDRVLTNPESDRVRQFLSRHLSAA