Protein Info for MPMX19_03570 in Azospirillum sp. SherDot2

Annotation: Phenoxybenzoate dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 118 to 135 (18 residues), see Phobius details PF00175: NAD_binding_1" amino acids 122 to 211 (90 residues), 23.1 bits, see alignment E=9.9e-09 PF00111: Fer2" amino acids 247 to 317 (71 residues), 57.4 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: None (inferred from 48% identity to sen:SACE_2819)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>MPMX19_03570 Phenoxybenzoate dioxygenase subunit beta (Azospirillum sp. SherDot2)
MSSTQPETPQPAAKAPWTLRVHRLDRITPQVRLVELRDPDGRGLPPAEPGAHIDLHLPDG
AVRSYSLCGDPADRHAYRIAVLNVPGGRGSGFVHGELALGADLTISPPRNNFRFDDAAHY
LFIAGGIGITPLLPMIRRAAEQGADWILHYCVRNAAAAPFLDDLRALPHGRVDLHAADDG
RRLAVDELLASTPVDVPVYCCGPQRLMEAVAAAARPDQDVRFEWFTPRPEAVRRDAADDS
FEVVCARSGVTVTVPAGTSILDALYAAGVEVDSSCEQGICGTCETTVLEGEPDHRDSVLS
DTERAAGKTMMLCVSRARSARLVLDV