Protein Info for MPMX19_03517 in Azospirillum sp. SherDot2

Annotation: Hydrogenase-4 component A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF12837: Fer4_6" amino acids 4 to 23 (20 residues), 24.5 bits, see alignment (E = 8.9e-09) amino acids 82 to 103 (22 residues), 27.9 bits, see alignment (E = 7.5e-10) PF12800: Fer4_4" amino acids 9 to 22 (14 residues), 15.1 bits, see alignment (E = 1.1e-05) amino acids 87 to 102 (16 residues), 20.4 bits, see alignment (E = 2.1e-07) PF13187: Fer4_9" amino acids 11 to 75 (65 residues), 27.3 bits, see alignment E=1.4e-09 amino acids 88 to 151 (64 residues), 28.6 bits, see alignment E=5.1e-10 PF13247: Fer4_11" amino acids 56 to 104 (49 residues), 31 bits, see alignment E=1.1e-10 PF12838: Fer4_7" amino acids 58 to 103 (46 residues), 33.5 bits, see alignment E=2.1e-11 PF12797: Fer4_2" amino acids 83 to 101 (19 residues), 24.6 bits, see alignment (E = 8e-09) PF00037: Fer4" amino acids 83 to 103 (21 residues), 26.7 bits, see alignment (E = 1.6e-09)

Best Hits

KEGG orthology group: K05796, electron transport protein HydN (inferred from 94% identity to azl:AZL_b04440)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>MPMX19_03517 Hydrogenase-4 component A (Azospirillum sp. SherDot2)
MNRFVTANPSKCIGCRTCEVACALAHSDGAGVEGLAPESFKPRIRMVKTADVSTAVMCHH
CEDAPCVNSCPNNAIVYRQHSVQVEQERCLGCKNCVLACPFGVMDVVTVPAVRQFAGMTL
SLGVKAQAHKCDLCIGRDAGPACVSVCPTSALTLMDRDAMDETLRRRRERAALEAAEVAA