Protein Info for MPMX19_03501 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details PF04955: HupE_UreJ" amino acids 14 to 170 (157 residues), 184.3 bits, see alignment E=1.6e-58 PF13795: HupE_UreJ_2" amino acids 33 to 138 (106 residues), 28.3 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 46% identical to HUPE_RHILV: Protein HupE (hupE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03192, urease accessory protein (inferred from 52% identity to azl:AZL_d02060)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>MPMX19_03501 hypothetical protein (Azospirillum sp. SherDot2)
MNRLFSAGLAGVLAATLALPAAAHTGHAGDAMFLQGVLHPLTGIDHLLTMVAVGIRAAQN
GGRAIWMLPAAFIAMLSGGAALGMAGIELPAVEAGIAASVAVLGLLVLLNRRVPVAAAAL
LVGAFAVLHGHAHGTEMPQTAEPLLYGLGFVLSTAMLHGAGIAMGLARHVPRRLLASRML
RQPDSSTSSGRC