Protein Info for MPMX19_03498 in Azospirillum sp. SherDot2

Annotation: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 7 to 285 (279 residues), 461.8 bits, E=3.4e-143
• PF12800: Fer4_4
  • amino acids 35 to 48 (14 residues), 15.1 bits, see alignment (E = 1.3e-05)
  • amino acids 128 to 142 (15 residues), 16.6 bits, see alignment (E = 4.4e-06)
• PF12838: Fer4_7
  • amino acids 36 to 111 (76 residues), 37.1 bits, E=2e-12
• PF13247: Fer4_11
  • amino acids 89 to 185 (97 residues), 87.4 bits, E=3.6e-28
• PF13237: Fer4_10
  • amino acids 91 to 141 (51 residues), 29.2 bits, 4.2e-10
• PF12837: Fer4_6
  • amino acids 122 to 144 (23 residues), 28.2 bits, see alignment (E = 7e-10)
• PF12797: Fer4_2
  • amino acids 123 to 142 (20 residues), 26.8 bits, see alignment (E = 1.8e-09)
• PF00037: Fer4
  • amino acids 125 to 144 (20 residues), 27.5 bits, see alignment (E = 1.1e-09)
• PF13187: Fer4_9
  • amino acids 129 to 181 (53 residues), 27 bits, 2e-09
• PF09163: Form-deh_trans
  • amino acids 243 to 285 (43 residues), 72.8 bits, 8.7e-24

Best Hits

Swiss-Prot: 65% identical to FDXH_HAEIN: Formate dehydrogenase iron-sulfur subunit (fdxH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 78% identity to cvi:CV_3840)

MetaCyc: 68% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• superpathway of C1 compounds oxidation to CO₂ (9/12 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• oxalate degradation VI (2/4 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• oxalate degradation III (2/5 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Protein Sequence (303 amino acids)

>MPMX19_03498 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (Azospirillum sp. SherDot2)
MTSSSLDIQRRSASPTAVAEARNPAEIAQLIDVSVCIGCKACQVACSEWNELRADVGTCV
GVYDNPTDLSSQAWTVMRFAEVEENGKLEWLIRKDGCMHCAEPGCLKACPSPGAIVQYKN
GIVDYNQDNCIGCGYCVSGCPFNVPRLSPKDGKAYKCNMCSDRVAVGLEPACVKTCPTGA
IQFGSKEDMKEVAATRIADLQSRGFQNAGLYDPPGVGGTHTMYVLHHADKPEQYSGLPND
PSISTAVGLWKGALKPLATVGIAAAGLFGFFHYITVGPNRADDDAHHDAHDDAKADTREE
DRS