Protein Info for MPMX19_03488 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 66 to 97 (32 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 337 to 361 (25 residues), see Phobius details amino acids 392 to 417 (26 residues), see Phobius details amino acids 428 to 451 (24 residues), see Phobius details amino acids 457 to 483 (27 residues), see Phobius details amino acids 504 to 527 (24 residues), see Phobius details amino acids 558 to 580 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 279 (169 residues), 40 bits, see alignment E=1.8e-14 amino acids 409 to 583 (175 residues), 31.4 bits, see alignment E=8.1e-12

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein K02054, putative spermidine/putrescine transport system permease protein (inferred from 68% identity to reh:H16_B1830)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>MPMX19_03488 hypothetical protein (Azospirillum sp. SherDot2)
MTMTHAPGAKRHSPPPAWRKPVLMGAPLVLLLIAFLVFPVGQLLALSVYNGQGFTLAPYA
QLFASSLYITVLWITLKISLATTVVAVIAAYPVAYLISIAKGPAKSRLIFWVLLSFWTSF
LVRAFAWVVILGRNGVVNSTLMSLGIIDTPADLLYGFGAVLIGMVHAMLPLAVMTMLAVM
ENIDRTLPRAAGTLGARPGTAFWTVYFPLSLPGVAASAIMVFVSAIGFFIVPALLGGRKE
TMITQLIIDQVQQTLNWGLAGAISVLLLTVVLVVFLLYDRVFGFASLTGESAVVRNRDTA
MRRLGGRVLAALGSASDALIGLVPRRLPIRGRSERPVALTAFVWLLLVLISLPAFLMIPL
SFGKGGLAWPPSGFTLQWYQQLLDSPIWMQALWRSIVVAFGTGLLSMAIGVPAAFLMVRS
QMRGKGAMLAFILSPIVVPRMIIAVGMFYVFAQMGLVGTILGLVIGHTVVAVPYVVMTMM
AVLRNYDTRLDLAAQSLGARPVAALRHVTFPILGAGMLSSFLFAFATSFDELTISLFSSG
GLSATLPKQFWDEVTLQVSPVIAAVSTGLLLFVATLIYVADRLRRRSLAG