Protein Info for MPMX19_03476 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 42 to 208 (167 residues), 53.5 bits, E=1.6e-18

Best Hits

Swiss-Prot: 46% identical to NIC1_ARATH: Nicotinamidase 1 (NIC1) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 90% identity to azl:AZL_d04340)

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• aldoxime degradation (1/3 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.19

Protein Sequence (254 amino acids)

>MPMX19_03476 hypothetical protein (Azospirillum sp. SherDot2)
MTETIMTPAIGPAAALEAVAAALPVRSTSVSLAGKRVGKLDVDPVNGFAAIGGGNLAPPV
ANAQVSRMIAEIDRTNRLFLSAGYPIAVFLDTHEPGKPEYPYPPHCEAGTGEENLVEELS
WLDGTPGVTLMRKDCINGVVGTTDLTTGQNRLFDWIAANGIETLVVDGICTDICVLQAVQ
ALLSARNHGMTGPLREIVVYEPGCSTYDLPLDTARSLGLPDTAAHPQAVAHHIGLYLMQA
SGAIIADGLVFGGA