Protein Info for MPMX19_03461 in Azospirillum sp. SherDot2

Annotation: Regulatory protein AtoC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF00072: Response_reg" amino acids 16 to 123 (108 residues), 103.2 bits, see alignment E=2.7e-33 PF00158: Sigma54_activat" amino acids 155 to 320 (166 residues), 244.9 bits, see alignment E=1.1e-76 PF14532: Sigma54_activ_2" amino acids 156 to 325 (170 residues), 81.2 bits, see alignment E=2.7e-26 PF00004: AAA" amino acids 178 to 311 (134 residues), 24.9 bits, see alignment E=7.2e-09 PF07728: AAA_5" amino acids 178 to 297 (120 residues), 28.9 bits, see alignment E=3.1e-10 PF02954: HTH_8" amino acids 431 to 470 (40 residues), 44.2 bits, see alignment 3.8e-15

Best Hits

Swiss-Prot: 57% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: K07714, two-component system, NtrC family, response regulator AtoC (inferred from 73% identity to rpc:RPC_0827)

Predicted SEED Role

"Acetoacetate metabolism regulatory protein AtoC" in subsystem Acetyl-CoA fermentation to Butyrate or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>MPMX19_03461 Regulatory protein AtoC (Azospirillum sp. SherDot2)
MTTQFPAMQAISAPAVLVVDDDEAIREMLAAVLTRDGLSVTTAADGVEAVAAFAAQRHAV
VLMDVRMPRMTGLQALAEIRKLDRSTAVILMTAYAEVGAAVQAIKDGAFDYVIKPFDIAE
ILLQVGRALQMRRMRDDIATLHRELSSSYRTDRILTASPRMSELLQTIAKVAKSNATVLV
TGESGTGKELVAAAIHYNSPRNAGPFVKVNCAAVPEGLLESEFFGHERGAFTGAQARRRG
RFEQAEHGTLFLDEIGDISPSLQVKLLRVLQEREFERVGGAELVRTDVRVIVATNRNLEE
MVRQGLFRQDLYFRLNVVTLRTVPLRERPEDVRLLASHFLQRFAAENRIDVSGIDEQAME
RLLAYRWPGNIRELSNAMERAVVMSTGAMIVTEDLPEQIAGRAGDSEPATDTDSDGAAAP
SAAGSLREQVSRFEARVVADALARNDGNRMKTAQQLGISRRSLLYKLQEYGIS