Protein Info for MPMX19_03377 in Azospirillum sp. SherDot2

Annotation: D-allose transport system permease protein AlsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 297 to 314 (18 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 336 (276 residues), 117.8 bits, see alignment E=2.5e-38

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 93% identity to azl:AZL_a02390)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>MPMX19_03377 D-allose transport system permease protein AlsC (Azospirillum sp. SherDot2)
MSATSAASPPSGTAPAPVPATVRLRMAGRALFIRLGVLPFFLAAALIVFALASDRFLTAD
NLVNVMRQSVYLVLVSLGQMMVLITGGFDLAVGATVALTSVVSALAMAALGQMFPDVPIL
VIALGALAGFAVAALVGLANGAGVALFGVSPFIMTLGVSSVAAGGSLFLTGGVPVSGLPA
EFADLFGFGRWLGIPVPVLVAAVAVAIAWVVMTRTRTGAHLYAVGGNIKAAKLSAIHTGR
TLIVAYVLCALIAALTGLLLTARVESGEANLGGTLALESIAACVIAGVSLRGGIGRVETV
VLGAFFIVLVQNGMNLAQIGSYLQMVLLGGLLILAVIFDQIRYRMMMTA