Protein Info for MPMX19_03357 in Azospirillum sp. SherDot2

Annotation: Polyketide biosynthesis protein PksE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02814: PfaD family protein
  • amino acids 61 to 503 (443 residues), 602.6 bits, E=2.1e-185
• PF03060: NMO
  • amino acids 82 to 332 (251 residues), 32.9 bits, E=4.6e-12
• PF21607: FabD_helical_ins
  • amino acids 379 to 458 (80 residues), 101.5 bits, E=2.4e-33

Best Hits

KEGG orthology group: None (inferred from 59% identity to scl:sce0818)

MetaCyc: 48% identical to icosapentaenoate synthase PfaD subunit (Photobacterium profundum SS9)
2.3.1.-

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9), inferred for PFA pathway" (EC 1.3.1.9)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• icosapentaenoate biosynthesis IV (bacteria) (1/1 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• biotin biosynthesis I (9/15 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Protein Sequence (526 amino acids)

>MPMX19_03357 Polyketide biosynthesis protein PksE (Azospirillum sp. SherDot2)
MPPLASPTASFDPSQLLELTQKAREPLYILRNRDGRLGASSLPPDLAGGELIPVATLPPL
YPEWLGDRAFPETHGCRFAYVAGEMARGIATPAMAVAAARAGLLGFYGSAGLSPQRVQEG
IAEIHAALGTQVPNWGANLIHSPNDPSLETAVCRLFQQQGVRRVSASAFMALTPSVMELA
ARGLSRDPATGAVHRLTHLFAKVSRAEVARQFMAPAPQRMLADLVTQGLLTTNEADLAST
IPVAEDITVEADSGGHTDNRPLCVLFPIVQRLRDELVAAHNYDRNIRVGAAGGLGTPAAI
AAAFAMGAAYVVVGSVNQSAAESGQPLSVRRMLAGLSSTDVTMAPAADMFEMGVKVQVMK
RGTLFPFRAQRLYELYCRHSGLEDLPAAERATLERDVFQAPLEEIWRQTREHFAVRDPAE
LGRAEADPRHRMALVFRWYLFNAARWPMLDDAARRHDFQVWCGPAMGAFNDWVKGSFLEA
AENRSVEQIARNLLEGAAVVTRAQQMRTAGLPVPAAAFTWVPRRLA