Protein Info for MPMX19_03315 in Azospirillum sp. SherDot2

Annotation: Transcriptional regulator KdgR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF09339: HTH_IclR" amino acids 29 to 78 (50 residues), 42.4 bits, see alignment 5e-15 PF01614: IclR" amino acids 148 to 266 (119 residues), 33.9 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: None (inferred from 39% identity to bgf:BC1003_4662)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>MPMX19_03315 Transcriptional regulator KdgR (Azospirillum sp. SherDot2)
MTGTDADPPELSADLPDTPDRERRYSAPALEKGLDILEFLSECRDPQSLQQIGDGVGRTK
GEIFRMVSVLAQRGYIERLEGDDRFRVTDRLFRLGMNRPVNRSLIEIALPFMNAFAEKTG
YSCHLAVMSGTQIAVVARVESTSHIGFTVRIGYRQPLVLTGSGHCLMAFIGARRRHGLYE
ELRQEDPWIDLDALDRTLDAVRAAGHVARPSGITEAVVDLSCPVIDRREGGAVAALTCPY
LRTRQVPKEPAEILTALDEASRRISEIFSLD