Protein Info for MPMX19_03257 in Azospirillum sp. SherDot2

Annotation: Glycine betaine/proline betaine transport system ATP-binding protein ProV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 49 to 342 (294 residues), 347.3 bits, see alignment E=5.4e-108 PF00005: ABC_tran" amino acids 52 to 199 (148 residues), 123.3 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 79% identity to ara:Arad_8147)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>MPMX19_03257 Glycine betaine/proline betaine transport system ATP-binding protein ProV (Azospirillum sp. SherDot2)
MTTVSSSEVLIDCQSVWKVFGDNAPAAIKAISERGLTKTAVLQEFNCVVGVSEASLQVRR
GEIFCIMGLSGSGKSTLIRLLNRLIMPSLGKVIVKGRDIATLNAAELRQMRARHIGMVFQ
SVALLPHRTVLENAAFGLEVQGIPAAERNRTAEKALAKVGLSDWLKRYPGELSGGMQQRV
GLARAIASDPEIILMDEPFSALDPLIRRQLQDEFRQLTKDLGKSAVFITHDLDEAIRIGD
RIAIMKDGLIIQVGTAEEIILKPADPYVAQFVAGISRLHLVKAHSVMIPVAEFQRTSPNI
DILSLLRTSPEADIDELITLTMMSDRDAVAVVDDDAIVGIVTTRGLLRSVSDGHTAELAP
A