Protein Info for MPMX19_03248 in Azospirillum sp. SherDot2

Annotation: 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00970: FAD_binding_6" amino acids 32 to 117 (86 residues), 43.5 bits, see alignment E=5e-15 PF00175: NAD_binding_1" amino acids 129 to 235 (107 residues), 50.9 bits, see alignment E=3.5e-17 PF00111: Fer2" amino acids 284 to 353 (70 residues), 56.3 bits, see alignment E=3.8e-19

Best Hits

KEGG orthology group: None (inferred from 65% identity to pde:Pden_2831)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>MPMX19_03248 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component (Azospirillum sp. SherDot2)
MTLLSDIGMAADAGLWTDDEPLECCSVVPEAPDTATVSFVAPSGARFGYRPGQFLTLELP
VPGGPVWRTYTISSSPSRPMGVSLTVKAQAGSAGTRWMLDTLRPGMRLRAKGPAGSFALL
PDARDKYLFLSAGSGVTPSVSMTTYLFDRGTGIDVVLVTCAKRPAELVCRRTLELMASRV
PSIKLHFIVEQDDPFDVWTGYRGRLNQVMLGAIAPDYLDRHVYCCGPEPFMKGVRDMLIA
LGFDMSRYFQESFSAPVLDTDETLETGDFVPDPSHAAEVVFSASGVTAGCDETDTILHVA
KNAGLNIPSGCTFGVCGTCKVRKLSGEVHMVHSGGISDDDIAEGYILACCSRPVGSISLD
I