Protein Info for MPMX19_03092 in Azospirillum sp. SherDot2

Annotation: High-affinity zinc uptake system membrane protein ZnuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 198 to 230 (33 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00950: ABC-3" amino acids 26 to 286 (261 residues), 166.9 bits, see alignment E=6.5e-53 PF01032: FecCD" amino acids 63 to 287 (225 residues), 37.2 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 81% identity to rru:Rru_A2388)

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, permease component" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>MPMX19_03092 High-affinity zinc uptake system membrane protein ZnuB (Azospirillum sp. SherDot2)
MSFETLRALIQGWAAAGWLPAGLTHGFLVNALLSGLVIGPVLGGLGTLVVTKRLAFFSEA
VGHAALTGVAIGILVGEPYTGPYASLFGYCLLFALLVNYTRNRSNLTSDTLIGVFLSVSL
ALGASLLLVLASRVNIHILENVLFGSVLTVDDRDLTVLLAVALGVALPMLALFNRLLLAS
FNPALARVRGVPVKGLDYLFIVLVTVVTVASVKIIGAILVGALLVIPAAAARVVATSLRG
FFLLSVAFASIAAVAGILLPVQFALPVPSGGAIILAAGLLFLGALLARLVMRGDEG