Protein Info for MPMX19_03066 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF13560: HTH_31" amino acids 3 to 55 (53 residues), 27.3 bits, see alignment 1.1e-09 PF13614: AAA_31" amino acids 73 to 249 (177 residues), 155.5 bits, see alignment E=4.3e-49 PF09140: MipZ" amino acids 73 to 221 (149 residues), 37.3 bits, see alignment E=6e-13 PF01656: CbiA" amino acids 74 to 295 (222 residues), 68.1 bits, see alignment E=2.3e-22 PF00142: Fer4_NifH" amino acids 79 to 327 (249 residues), 31.7 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to azl:AZL_b00240)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>MPMX19_03066 hypothetical protein (Azospirillum sp. SherDot2)
MKGDELRTHRETKGLSQSEFAVWLNERLQRRYDKQKISRWENDAERIPAAVDALMTREIN
GPEPERLGGPALVVVVANQKGGCAKTVSAVNIASALAIKGYATMLIDCDPQANATQHLGI
DSYTMETEGKTLYYVMHGDLELDDILVTVPESGLRVAPSSIRLAETEVELGKEAGGDFIM
KEKIAAAKRSFDFIVIDTPPNIGELTKNAMVAAHTAVIPCQTEKFSLLGMAFLLENVTKI
RRRMNTGLSVLGIVPTIFKQRERNDREVLEQIHEEYGPHLRVFDPVPKASVYAQATSVGR
AAVEAMPDVAGAAVYRDVASALAEERTARIKEVDRVA