Protein Info for MPMX19_03065 in Azospirillum sp. SherDot2

Annotation: Nucleoid occlusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 36 to 179 (144 residues), 110.9 bits, see alignment E=3.2e-36 PF02195: ParBc" amino acids 38 to 120 (83 residues), 74.2 bits, see alignment E=3.9e-25

Best Hits

KEGG orthology group: None (inferred from 89% identity to azl:AZL_b00230)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>MPMX19_03065 Nucleoid occlusion protein (Azospirillum sp. SherDot2)
MSRSLLGKATKPAQSATAAARMKDALFGLSRHAPHLVEVSVDRIAPNPNQPRREFDEEEL
RGLASSIERHGLQQPIGVRQTADDRWQLVYGERRLRAMRMLGRETIFGILFTGDDDEEIA
IVENLQRSDLNPLEESDALARLAERHGYSHRQLAEALGRKKTYVTMMLSFQRLAPAIRED
YPLLRPTKAKLEALAAIDDRDEQLRAWEKLKRAEMGSLPSSPAAPAAAPSRREPVSAPAG
IASSALPARTAKPVFQARDVLRELQAKPQSLSDTDRQALADMRNAIDAILAAAGQ