Protein Info for MPMX19_03058 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 455 to 474 (20 residues), see Phobius details amino acids 490 to 516 (27 residues), see Phobius details amino acids 528 to 552 (25 residues), see Phobius details amino acids 591 to 611 (21 residues), see Phobius details amino acids 630 to 652 (23 residues), see Phobius details PF04205: FMN_bind" amino acids 102 to 180 (79 residues), 29.5 bits, see alignment E=1e-10 PF12801: Fer4_5" amino acids 531 to 576 (46 residues), 51 bits, see alignment 1.2e-17 amino acids 632 to 669 (38 residues), 25.9 bits, see alignment 7.5e-10

Best Hits

KEGG orthology group: None (inferred from 60% identity to rpx:Rpdx1_3444)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (773 amino acids)

>MPMX19_03058 hypothetical protein (Azospirillum sp. SherDot2)
MPKGKSRRVAVVRFRRVQRWVGSALVALLLLLTGIGPDIATAEAADSGRLLPYLAKLQPS
DLVPGADRFGQPTPNTPTVPVYKGDAVVGHAYLTSDFVNTTGYSGRPIDVVVGLTADGTV
TGARLMDHHEPIVLIGIPPARINGFINGYVGKNVLTLATQSAASPPVDIVSGATVTVMVI
GDSIIRSGKKVMQSLGKAGPDSAPTIVKSVDLSKTAVEDWTTLIGDGSVRRLTLTVGEVN
AAFEKTGRAEAIARAEAGSPDETFIDLYAALVSIPSIGRSLLGDAEYETLTKRLKPGQQA
VWVAGQGRYSFKGSGYVRGGIFDRVEMIQHEGSIRFRDKMHKRLGSVAAAGAPDFPEIGL
FVLPEGTEFNPADPWRLQLLVQRAIAALDKVFVTFDLGYQPPDKYLKTEQPAPTVAASPD
QSASHSAAIQAAGAEAAEEAAEVPLWQRIWQNRQLDITVLASAILLLTGIFFFQDQLTKR
PKLYEHVRTAYLVFTLVWLGWYATAQLSVVNILTFANALRTDFRWDYFMMDPLVFILWFS
VAASLLFWGRGAFCGWLCPFGALQELASKAAKRIGIRQITVPFALHQRLWPIKYIVFLLL
FGVSLQSLGTAEKAAEIEPFKTAIILHFIRDWWFVAFAVALLAAGLVIERFFCRYLCPLG
AALAIPGRLRMFDWLRRYKECGSPCQRCGNECPVQAIHPDGSINPNECIQCLHCQMLYHH
DHKCPVMIQKRQKREKWQAAEAKLAAEKEAAARSTVATADPATGRLTIRPHGS