Protein Info for MPMX19_03017 in Azospirillum sp. SherDot2

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF13188: PAS_8" amino acids 23 to 68 (46 residues), 41.1 bits, see alignment 4e-14 amino acids 150 to 198 (49 residues), 29.6 bits, see alignment 1.7e-10 TIGR00229: PAS domain S-box protein" amino acids 23 to 145 (123 residues), 110 bits, see alignment E=4.3e-36 amino acids 146 to 273 (128 residues), 120.9 bits, see alignment E=1.9e-39 PF00989: PAS" amino acids 23 to 134 (112 residues), 63.4 bits, see alignment E=6.9e-21 amino acids 151 to 262 (112 residues), 66.1 bits, see alignment E=1e-21 PF08448: PAS_4" amino acids 28 to 96 (69 residues), 31.6 bits, see alignment E=6e-11 PF13426: PAS_9" amino acids 32 to 137 (106 residues), 45.4 bits, see alignment E=2.9e-15 amino acids 160 to 265 (106 residues), 41.7 bits, see alignment E=4.1e-14 PF00512: HisKA" amino acids 289 to 350 (62 residues), 34.4 bits, see alignment E=6.7e-12 PF02518: HATPase_c" amino acids 400 to 522 (123 residues), 82.2 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: K14986, two-component system, LuxR family, sensor kinase FixL [EC: 2.7.13.3] (inferred from 88% identity to azl:AZL_b06310)

Predicted SEED Role

"Two-component oxygen-sensor histidine kinase FixL" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (534 amino acids)

>MPMX19_03017 Adaptive-response sensory-kinase SasA (Azospirillum sp. SherDot2)
MADDSRDDNRADDQDQNLGALSQLQAMLDTVPDGVVIIDDRGRITSFNPACERLFGWAAA
EVVGRNVNILMPAPYREEHDGYLERYHRTGERRIIGIGREVTGQRKDGSCFPMDLSVGEA
SQDGPPVYIGIIRDLTASRQAETALREREARLASILQTVPEAIIVIDEKGLIESFSPAAE
RLFGYAAAEVAGRNISMLMPSPYREQHDGYLERYGRTGERRIIGIGRIVSGQRRDGSVFP
MELAVGEVLLAGRRCFTGFVRDLTERQATERRLQELQSELLHVSRVSAMGQMASTLAHEL
NQPLTAVINYAKAAKRLMERPETVSKAMDMVDKASAQATRAGQIIRHLRSFIEKGKTHRS
VESLNKVVEEASALALVGAKDRGLHVRFDFEPADPQVLIDKVQVQQVILNLVRNAIEAMG
GAPGGQRVLTVRTGPEPADEAFRRVSVTDSGPGVPETVRAQLFQPFVTTKSSGMGLGLSI
CRSIIEAHGGRLWLEPAADLPTESPAEPPSTGASFAFTVPLSTSLSASDADDAS