Protein Info for MPMX19_02925 in Azospirillum sp. SherDot2

Annotation: Hydrazine synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 17 to 324 (308 residues), 500.4 bits, see alignment E=1.7e-154 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 106 to 146 (41 residues), 47.5 bits, see alignment 1.4e-16 amino acids 282 to 322 (41 residues), 54.4 bits, see alignment 9.5e-19

Best Hits

KEGG orthology group: None (inferred from 61% identity to mno:Mnod_5316)

Predicted SEED Role

"FIG00443700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>MPMX19_02925 Hydrazine synthase subunit beta (Azospirillum sp. SherDot2)
MRFLLSCTLLLLAGPVLVAEPLLAETIFVSNEKDNQIAVVDGDSLQIKNKIKVGRRPRGI
TLSADGTQLYVCVGDDNRIDVVDIASGKIVHTLPSGPDPELFVLSPDGTKLYVANENDNM
VTVIDVAERKAIGNIQVGVEPEGMGISPDGKILVNTSETTNMAHFIDTEKHAVVGNVLVD
SRPRVARFTDDGKQVWVSSEIGGTVSVIDAAAHKVIKKIRFEVTGVRREAIQAVGIQMTK
DGKRAFVALGPANRIAEIDTGSLEVKRYFLVGQRVWNLAFSPDEKRLYTTNGISNDLSVI
DLERNKVIKSIPVGGAPWGIVVKP