Protein Info for MPMX19_02852 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details PF04632: FUSC" amino acids 19 to 359 (341 residues), 68.6 bits, see alignment E=9.5e-23 PF06081: ArAE_1" amino acids 27 to 160 (134 residues), 27.7 bits, see alignment E=5.5e-10 PF13515: FUSC_2" amino acids 33 to 158 (126 residues), 76.8 bits, see alignment E=3.3e-25 PF11744: ALMT" amino acids 43 to 174 (132 residues), 27.2 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: None (inferred from 84% identity to azl:AZL_b03030)

Predicted SEED Role

"FIG00799465: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>MPMX19_02852 hypothetical protein (Azospirillum sp. SherDot2)
MSGWRSVPASWVARNRSKLVHALRMTASTLATFALAEVLDLPQGFWAVITALIVTQSNVG
GSLKAALDRFVGSLVGVAYGGAIAMLIPHTDGLARAAALLAAVAPLSYLAAKSAGFRIAP
ITAIIVLLGSAGASLGPLSFATDRMLEVGLGCIVGILVSLLVVPARASRSVLDTAAEAAR
LMAEQLDALAVTDDASQAIMNRLVVRTRQALTRLETLVGEAARERRSRLADMPDPDPLLR
TLMRLRHDVVMLRRAVGEPRQDIADRDVCPDWTPVAAAGASTLRGLADALATGQPPDRST
ALADALAGYRAGIDRTRAERRTRDMPTDWLWRMFGTGFALEQFRRNLDDLVERTADFAAH
R