Protein Info for MPMX19_02848 in Azospirillum sp. SherDot2

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details PF00892: EamA" amino acids 18 to 150 (133 residues), 48.2 bits, see alignment E=6.5e-17 amino acids 159 to 289 (131 residues), 49.4 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: None (inferred from 90% identity to azl:AZL_b03060)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX19_02848 Riboflavin transporter (Azospirillum sp. SherDot2)
MEQVPTSAAAKPPENVRLGILSMLLAMALMTIMNALAKILAESYPLGEVTFFRNLFALLP
AVAMVAAAGGRSCLHTDHWQGHLWRAIVGLASMVLLFWAYHLMPLANAVAISYSAPLFLT
ALSVPLLGERVGAFRWGAVAVGFAGVLIMVQPGAGMLDRGALVALTAAVCYALAMIAMRQ
LGRTEKPVTTVFYFTVVSTLLSALALPFGWTTPDGHALVLMAGMGIAGGGAQYFSTRAYS
LARAVVVGPFSYASLIYATILGWLVWGDVPAPHVIVGATVVIGSGLLILYRETRRAAASP
PKPCTTHSGPGPIRTA