Protein Info for MPMX19_02847 in Azospirillum sp. SherDot2

Annotation: Acetate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00016: acetate kinase
  • amino acids 11 to 396 (386 residues), 366.9 bits, E=5.7e-114
• PF00871: Acetate_kinase
  • amino acids 12 to 393 (382 residues), 378.4 bits, E=1.7e-117

Best Hits

Swiss-Prot: 55% identical to ACKA_RHIME: Acetate kinase (ackA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 95% identity to azl:AZL_b03070)

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

• mixed acid fermentation (14/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-threonine degradation I (6/6 steps found)
• ethanolamine utilization (5/5 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)
• L-lysine fermentation to acetate and butanoate (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• methanogenesis from acetate (2/6 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (3/9 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• superpathway of methanogenesis (5/21 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.1

Use Curated BLAST to search for 2.7.2.1

Protein Sequence (408 amino acids)

>MPMX19_02847 Acetate kinase (Azospirillum sp. SherDot2)
MVALSNSSEDACLVINAGSSSLKFCVFQGGSATEIEPVVTGQISGIGTAPRFEAKDAARH
KIADHSWADGENPGRPELLHHLLDWIGDTLKGATLVAAGHRVVHGGTRFSAPVRVTPAVL
DQLEELIPLAPLHEPHNIAAMRALAQVYPSLPQVACFDTAFHQTQPWQSQTFAIPRELTA
EGIRRYGFHGLSYEYIAHRLPQVAPELADAHVVVCHLGSGASLCAMRGGHSVDTTMGFTA
LDGVPMGTRPGTIDPGVLIYLMREKGYGADELEKLLYHKSGMLGVSGISNDMRDLESSDL
PAAAEAVELFCHNVAKQVAALAGSMGGLDAVVFTAGVGENSTLVRSRVAEKLSWLGVAID
PAANRAKATRISAQESRVPVFIIPTDEERMIARHTLGVIAAEQLERAA