Protein Info for MPMX19_02844 in Azospirillum sp. SherDot2

Annotation: putative formate transporter 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 84 to 113 (30 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 27 to 285 (259 residues), 245.4 bits, see alignment E=2.8e-77

Best Hits

KEGG orthology group: None (inferred from 97% identity to azl:AZL_b03100)

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>MPMX19_02844 putative formate transporter 1 (Azospirillum sp. SherDot2)
MNMDSKDVGGWSQPTPQTLDALMPDAIALAAENLGVKKAHYDTPTLFALAVLAGAFIAMG
GLFATVAMSGAEGMLPYGVTRLLGGLVFSMGLILVIVGGAQLFTGDALMVMAWASGRLHA
REMMRVWTTVWIGNFVGAAGTALLVFLSGQYTFGHGAVGASALYFAVAKSSLPTTQAFFL
GILCNVLVCLAVWLALGARSVGDKILAITFPVAAFVAAGFEHCVANMYFVPLGLLIEWGA
PDSFWHDLGRAAPSIPVGHYLVNLAAVTLGNWIGGAVMVGAVYWFIYRRPKLR