Protein Info for MPMX19_02838 in Azospirillum sp. SherDot2

Annotation: Malonate decarboxylase acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03130: malonate decarboxylase acyl carrier protein
  • amino acids 2 to 99 (98 residues), 117 bits, E=1.4e-38
• PF06857: ACP
  • amino acids 21 to 98 (78 residues), 86 bits, E=8.8e-29

Best Hits

Swiss-Prot: 60% identical to MDCC_STRMK: Malonate decarboxylase acyl carrier protein (mdcC) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K13931, malonate decarboxylase delta subunit (inferred from 84% identity to azl:AZL_b03150)

MetaCyc: 39% identical to malonate decarboxylase acyl-carrier protein subunit (Malonomonas rubra)
RXN-9774 [EC: 7.2.4.4]

Predicted SEED Role

"Malonate decarboxylase delta subunit" in subsystem Malonate decarboxylase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.4.4

Protein Sequence (106 amino acids)

>MPMX19_02838 Malonate decarboxylase acyl carrier protein (Azospirillum sp. SherDot2)
MEILSFEYRGGRPVASPPPSVLVGVVGSGNLEVLVEPAPLGGICRVEIQTAAVGFGTTWQ
AVLDDVFARHPLADVRISINDVGATPAVVSLRLDQALDAFAGGSQP