Protein Info for MPMX19_02826 in Azospirillum sp. SherDot2

Annotation: Dipeptide transport system permease protein DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 246 to 272 (27 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 8 to 107 (100 residues), 51.1 bits, see alignment E=1.5e-17 PF00528: BPD_transp_1" amino acids 118 to 323 (206 residues), 149.7 bits, see alignment E=8e-48

Best Hits

Swiss-Prot: 40% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 96% identity to azl:AZL_b03270)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>MPMX19_02826 Dipeptide transport system permease protein DppB (Azospirillum sp. SherDot2)
MLGFAQLFASRLVKAAAILIAIVVMNFFLVHAAPGDPAMVMAGEAGAADEKFVTQLREQF
GLDRPLYEQLGTYIGKVVQGDLGFSYRQQRPVWDILAERLPATLVLTLTAFILALAAGVA
LGTLAAVTVGTWADSAITVIALLAYATPIYWIGLMLSLLFSIQLGWLPAFGYETIGAGYT
GLAHVADVAVHLILPVITLALFYMAGYARLTRASMLEVRSLDFVKTAKAKGLTQGRIVTR
HVLRNAILPVITVAGIQAGQLVGGSILIETVFAWPGIGRLAFEAVLQRDYQVLLGIFLVT
SIMVILFNILTDILYGLVDPRIQVSQ